PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678312710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YA
Protein Properties Length: 230aa    MW: 26268.6 Da    PI: 7.7022
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678312710genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA51.82.7e-16159195138
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpy 38 
                +ep+YVNaKQy++Il+RRq+Rak+e e+kl +k+rk  
  678312710 159 QEPVYVNAKQYHGILRRRQSRAKAELERKL-IKERKAL 195
                69****************************.9999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.1E-9157211IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115217.726158193IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.3E-12160194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860163183IPR018362CCAAT-binding factor, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MQPNSKSDNQ GAPNTLSVVD STACPVPWWN NAVYNSFNRI LMRKNVSDSS SMERSVDGHS  60
LSEGINEEDE DAAKHSSSAV KNYNRDSQNH FQVSSTLHPR NDRSFTQAPQ FELIGHTVAC  120
SNPYDPYHGG LIAPYGQPLV PHMYDIHHTR MPLPLEMTQE PVYVNAKQYH GILRRRQSRA  180
KAELERKLIK ERKALYYLIF PCILLSLFFS YELPFTHCSH IFTSLGINMQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012844659.11e-80PREDICTED: nuclear transcription factor Y subunit A-1
RefseqXP_012844660.11e-80PREDICTED: nuclear transcription factor Y subunit A-1
TrEMBLA5PGU32e-81A5PGU3_ANTMA; YA4
STRINGPGSC0003DMT4000189581e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31112248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.37e-33nuclear factor Y, subunit A1